www.wikidata.de-de.nina.az

Enfuvirtid ENF Handelsname Fuzeon Hoffmann La Roche ist ein Arzneistoff zur Behandlung HIV infizierter Patienten 1 Es ge

Enfuvirtid

Enfuvirtid (ENF, Handelsname: Fuzeon, Hoffmann-La Roche) ist ein Arzneistoff zur Behandlung HIV-infizierter Patienten. Es gehört zur Gruppe der Fusionsinhibitoren (Entry-Inhibitoren).

Enfuvirtid
Masse/Länge Primärstruktur 36 Aminosäuren, 4492 Dalton
Bezeichner
Externe IDs
Arzneistoffangaben
ATC-Code J05AX07
DrugBank DB00109
Wirkstoffklasse Fusionsinhibitoren

Struktur Bearbeiten

Acetyl-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-amid.

Pharmakologie Bearbeiten

Enfuvirtid unterbindet die Fusion von HIV-1 und der Wirtszelle und somit die Infektion der Zelle. Die ersten Schritte dieser Fusion bestehen in der Anlagerung des Oberflächenproteins gp120 an den CD4-Rezeptor und einen Corezeptor. Diese Anlagerung bewirkt Konformationsänderungen des Proteins, wodurch gp41 freigelegt wird und eine Konformationsänderung durchläuft. Dadurch gelangen die Membran der Zielzelle und die des Virus in Kontakt und verschmelzen miteinander, wodurch das Virus in die Zelle eindringen kann. Enfuvirtid verhindert die Konformationsänderung durch Andockung an gp41 und somit die Infektion.

Enfuvirtid wirkt gegen HIV-1, es besteht keine Aktivität gegen HIV-2. Bisher wurden keine Kreuzresistenzen zwischen der Substanz und anderen Arzneistoffen festgestellt.

Pharmakokinetik Bearbeiten

Enfuvirtid wird schnell im Magen-Darm-Trakt abgebaut und ist somit nicht oral bioverfügbar. Nach subkutaner Injektion wird die Substanz gut resorbiert. Bei zweimal täglicher Gabe von 90 mg schwankten die Konzentrationen im Plasma zwischen etwa 3 und 5 µg/ml. Die Halbwertzeit beträgt ca. 3,8 Stunden.

Nebenwirkungen Bearbeiten

Enfuvirtid wird gut vertragen. Die häufigsten Nebenwirkungen sind milde lokale Reaktionen an der Einstichstelle. Bei 9,4 % der Patienten wurde eine Anwendung von Analgetika erforderlich. Die Behandlung wurde von 3 % der Patienten abgebrochen. Wechselwirkungen sind bisher nicht bekannt.

Weblinks Bearbeiten

Einzelnachweise Bearbeiten

  1. AIDS Meds - Amerikanische HIV Medikamenten Website.
  2. International Nonproprietary Names for Pharmaceutical Substances (INN).
  3. Esté JA, Telenti A: HIV entry inhibitors. In: The Lancet. 370. Jahrgang, Nr. 9581, Juli 2007, S. 81–8, doi:10.1016/S0140-6736(07)61052-6, PMID 17617275.

Literatur Bearbeiten

  • Greenberg ML, Melby T, Sista P, et al. Baseline and on-treatment susceptibility to enfuvirtide seen in TORO 1 and 2 to 24 weeks. Abstract 141, 10th CROI 2003, Boston.
  • Lalezari J, Cohen C, Eron J, and the T20-205 study group. Forty eight week analysis of patients receiving T-20 as a component of multidrug salvage therapy. Abstract LbPp116, XIII Int AIDS Conf 2000, Durban, South Africa.
  • Lalezari J, DeJesus E, Northfelt D, et al. A week 48 assessment of a randomized, controlled, open-label phase II trial (T20-206) evaluating 3 doses of T-20 in PI-experienced, NNRTI-naïve patients infected with HIV-1. Abstract 418, 9th CROI 2002, Seattle, USA.
  • Lazzarin A, Queiroz-Telles F, Frank I, et al. TMC114 provides durable viral load suppression in treatment-experienced patients: POWER 1 and 2 combined week 48 analysis. TUAB0104, XVI IAC 2006, Toronto.
  • Lu J, Sista P, Cammack N, Kuritzkes D, et al. Fitness of HIV-1 clinical isolates resistant to T-20 (enfuvirtide). In: Antiviral Therapy, 2002, 7:S56
  • Walmsley S, Henry K, Katlama C, et al. Lack of influence of gp41 antibodies that cross-react with enfuvirtide on the efficacy and safety of enfuvirtide in TORO 1 and TORO 2 Phase III trials. Abstract 558, 10th CROI 2003, Boston.
  • Harris M, Joy R, Larsen G, et al. Enfuvirtide plasma levels and injection site reactions using a needle-free gas-powered injection system (Biojector). In: AIDS, 2006, 20:719-23. PMID 16514302
  • Hicks CB, Cahn P, Cooper DA, et al. Durable efficacy of tipranavir-ritonavir in combination with an optimised background regimen of antiretroviral drugs for treatment-experienced HIV-1-infected patients at 48 weeks in the RESIST studies: an analysis of combined data from two randomised open-label trials. In: The Lancet, 2006, 368:466-475. PMID 16890833
  • Kilby JM, Hopkins S, Venetta TM, et al. Potent suppression of HIV-1 replication in humans by T-20, a peptide inhibitor of gp41-mediated virus entry. In: Nat Med. 1998, 4:1302-1307. PMID 9809555
  • Kilby JM, Lalezari JP, Eron JJ, et al. The safety, plasma pharmacokinetics, and antiviral activity of subcutaneous enfuvirtide (T-20), a peptide inhibitor of gp41-mediated virus fusion, in HIV-infected adults. In: AIDS Res Hum Retroviruses, 2002, 18:685-93. PMID 12167274
  • Lalezari JP, Henry K, O’Hearn M, et al. Enfuvirtide, an HIV-1 fusion inhibitor, for drug-resistant HIV infection in North and South America. In: N Engl J Med. 2003, 348:2175-85. PMID 12637625
  • Lalezari J, Godrich J, DeJesus E, et al. Efficacy and safety of maraviroc plus optimized background therapy in viremic, ART-experienced patients infected with CCR5-tropic HIV-1: 24-week results of a phase 2b/3 study in the US and Canada. Abstract 104LB, 14th CROI 2007, Los Angeles.
  • Lazzarin A, Clotet B, Cooper D, et al. Efficacy of enfuvirtide in patients infected with drug-resistant HIV-1 in Europe and Australia. In: N Engl J Med. 2003, 348:2186-95. PMID 12773645
  • Lehrman G, Hogue IB, Palmer S, et al. Depletion of latent HIV-1 infection in vivo: a proof-of-concept study. In: Lancet 2005; 366: 549-55, PMID 16099290.
  • Melby T, Sista P, DeMasi R, et al. Characterization of envelope glycoprotein gp41 genotype and phenotypic susceptibility to enfuvirtide at baseline and on treatment in the phase III clinical trials TORO-1 and TORO-2. In: AIDS Res Hum Retroviruses, 2006; 22: 375-85. Abstract: PMID 16706613
  • Menzo S, Castagna A, Monachetti A, et al. Resistance and replicative capacity of HIV-1 strains selected in vivo by long-term enfuvirtide treatment. In: New Microbiol. 2004, 27:51-61. PMID 15646065
  • Mink M, Mosier SM, Janumpalli S, et al. Impact of human immunodeficiency virus type 1 gp41 amino acid substitutions selected during enfuvirtide treatment on gp41 binding and antiviral potency of enfuvirtide in vitro. In: J Virol. 2005, 79:12447-54. PMID 16160172
  • Molto J, Ruiz L, Valle M, et al. Increased antiretroviral potency by the addition of enfuvirtide to a four-drug regimen in antiretroviral-naive, HIV-infected patients. In: Antivir Ther. 2006; 11: 47-51. Abstract: PMID 16518959
  • Nelson M, Arasteh K, Clotet B, et al. Durable efficacy of enfuvirtide over 48 weeks in heavily treatment-experienced HIV-1-infected patients in the T-20 versus optimized background regimen only 1 and 2 clinical trials. In: J AIDS, 2005, 40:404-12. PMID 16280694
  • Nelson M, Fätkenheuer G, Konourina I, et al. Efficacy and safety of maraviroc plus optimized background therapy in viremic, ART-experienced patients infected with CCR5-tropic HIV-1 in Europe, Australia and North America: 24 week results. Abstract 104aLB, 14th CROI 2007, Los Angeles.
  • Oldfield V, Keating GM, Plosker G: Enfuvirtide: A Review of its Use in the Management of HIV Infection. In: Drugs, 2005, 65:1139-60. PMID 15907147
  • Raffi F, Katlama C, Saag M, et al.: Week-12 response to therapy as a predictor of week 24, 48, and 96 outcome in patients receiving the HIV fusion inhibitor enfuvirtide in the T-20 versus Optimized Regimen Only (TORO) trials. In: Clin Infect Dis. 2006; 42: 870-877, PMID 16477567.
  • Stocker H, Kloft C, Plock N, et al. Pharmacokinetics of enfuvirtide in patients treated in typical routine clinical settings. In: Antimicrob Agents Chemother. 2006, 50:667-73. PMID 16436725
  • Thompson M, DeJesus E, Richmond G, et al. Pharmacokinetics, pharmacodynamics and safety of once-daily versus twice-daily dosing with enfuvirtide in HIV-infected subjects. In: AIDS, 2006, 20:397-404, PMID 16439873.
  • Trottier B, Walmsley S, Reynes J, et al. Safety of enfuvirtide in combination with an optimized background of antiretrovirals in treatment-experienced HIV-1-infected adults over 48 weeks. In: JAIDS 2005, 40:413-421, PMID 16280695.
  • Youle M, Staszweski S, Clotet B, et al. Concomitant use of an active boosted protease inhibitor with enfuvirtide in treatment-experienced, HIV-infected individuals: recent data and consensus recommendations. In: HIV Clin Trials, 2006; 7: 86-96, PMID 16798623.
wikipedia, wiki, deutsches, deutschland, buch, bücher, bibliothek artikel lesen, herunterladen kostenlos kostenloser herunterladen, MP3, Video, MP4, 3GP, JPG, JPEG, GIF, PNG, Bild, Musik, Lied, Film, Buch, Spiel, Spiele
Veröffentlichungsdatum:
Enfuvirtid ENF Handelsname Fuzeon Hoffmann La Roche ist ein Arzneistoff zur Behandlung HIV infizierter Patienten 1 Es gehort zur Gruppe der Fusionsinhibitoren Entry Inhibitoren EnfuvirtidMasse Lange Primarstruktur 36 Aminosauren 4492 DaltonBezeichnerExterne IDs CAS Nummer 159519 65 0ArzneistoffangabenATC Code J05AX07DrugBank DB00109Wirkstoffklasse Fusionsinhibitoren Inhaltsverzeichnis 1 Struktur 2 Pharmakologie 3 Pharmakokinetik 4 Nebenwirkungen 5 Weblinks 6 Einzelnachweise 7 LiteraturStruktur BearbeitenAcetyl YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF amid 2 Pharmakologie BearbeitenEnfuvirtid unterbindet die Fusion von HIV 1 und der Wirtszelle und somit die Infektion der Zelle Die ersten Schritte dieser Fusion bestehen in der Anlagerung des Oberflachenproteins gp120 an den CD4 Rezeptor und einen Corezeptor Diese Anlagerung bewirkt Konformationsanderungen des Proteins wodurch gp41 freigelegt wird und eine Konformationsanderung durchlauft Dadurch gelangen die Membran der Zielzelle und die des Virus in Kontakt und verschmelzen miteinander wodurch das Virus in die Zelle eindringen kann Enfuvirtid verhindert die Konformationsanderung durch Andockung an gp41 und somit die Infektion 3 Enfuvirtid wirkt gegen HIV 1 es besteht keine Aktivitat gegen HIV 2 Bisher wurden keine Kreuzresistenzen zwischen der Substanz und anderen Arzneistoffen festgestellt Pharmakokinetik BearbeitenEnfuvirtid wird schnell im Magen Darm Trakt abgebaut und ist somit nicht oral bioverfugbar Nach subkutaner Injektion wird die Substanz gut resorbiert Bei zweimal taglicher Gabe von 90 mg schwankten die Konzentrationen im Plasma zwischen etwa 3 und 5 µg ml Die Halbwertzeit betragt ca 3 8 Stunden Nebenwirkungen BearbeitenEnfuvirtid wird gut vertragen Die haufigsten Nebenwirkungen sind milde lokale Reaktionen an der Einstichstelle Bei 9 4 der Patienten wurde eine Anwendung von Analgetika erforderlich Die Behandlung wurde von 3 der Patienten abgebrochen Wechselwirkungen sind bisher nicht bekannt Weblinks BearbeitenOffentlicher Beurteilungsbericht EPAR der europaischen Arzneimittelagentur EMA zu EnfuvirtidEinzelnachweise Bearbeiten AIDS Meds Amerikanische HIV Medikamenten Website International Nonproprietary Names for Pharmaceutical Substances INN Este JA Telenti A HIV entry inhibitors In The Lancet 370 Jahrgang Nr 9581 Juli 2007 S 81 8 doi 10 1016 S0140 6736 07 61052 6 PMID 17617275 Literatur BearbeitenGreenberg ML Melby T Sista P et al Baseline and on treatment susceptibility to enfuvirtide seen in TORO 1 and 2 to 24 weeks Abstract 141 10th CROI 2003 Boston Lalezari J Cohen C Eron J and the T20 205 study group Forty eight week analysis of patients receiving T 20 as a component of multidrug salvage therapy Abstract LbPp116 XIII Int AIDS Conf 2000 Durban South Africa Lalezari J DeJesus E Northfelt D et al A week 48 assessment of a randomized controlled open label phase II trial T20 206 evaluating 3 doses of T 20 in PI experienced NNRTI naive patients infected with HIV 1 Abstract 418 9th CROI 2002 Seattle USA Lazzarin A Queiroz Telles F Frank I et al TMC114 provides durable viral load suppression in treatment experienced patients POWER 1 and 2 combined week 48 analysis TUAB0104 XVI IAC 2006 Toronto Lu J Sista P Cammack N Kuritzkes D et al Fitness of HIV 1 clinical isolates resistant to T 20 enfuvirtide In Antiviral Therapy 2002 7 S56 Walmsley S Henry K Katlama C et al Lack of influence of gp41 antibodies that cross react with enfuvirtide on the efficacy and safety of enfuvirtide in TORO 1 and TORO 2 Phase III trials Abstract 558 10th CROI 2003 Boston Harris M Joy R Larsen G et al Enfuvirtide plasma levels and injection site reactions using a needle free gas powered injection system Biojector In AIDS 2006 20 719 23 PMID 16514302 Hicks CB Cahn P Cooper DA et al Durable efficacy of tipranavir ritonavir in combination with an optimised background regimen of antiretroviral drugs for treatment experienced HIV 1 infected patients at 48 weeks in the RESIST studies an analysis of combined data from two randomised open label trials In The Lancet 2006 368 466 475 PMID 16890833 Kilby JM Hopkins S Venetta TM et al Potent suppression of HIV 1 replication in humans by T 20 a peptide inhibitor of gp41 mediated virus entry In Nat Med 1998 4 1302 1307 PMID 9809555 Kilby JM Lalezari JP Eron JJ et al The safety plasma pharmacokinetics and antiviral activity of subcutaneous enfuvirtide T 20 a peptide inhibitor of gp41 mediated virus fusion in HIV infected adults In AIDS Res Hum Retroviruses 2002 18 685 93 PMID 12167274 Lalezari JP Henry K O Hearn M et al Enfuvirtide an HIV 1 fusion inhibitor for drug resistant HIV infection in North and South America In N Engl J Med 2003 348 2175 85 PMID 12637625 Lalezari J Godrich J DeJesus E et al Efficacy and safety of maraviroc plus optimized background therapy in viremic ART experienced patients infected with CCR5 tropic HIV 1 24 week results of a phase 2b 3 study in the US and Canada Abstract 104LB 14th CROI 2007 Los Angeles Lazzarin A Clotet B Cooper D et al Efficacy of enfuvirtide in patients infected with drug resistant HIV 1 in Europe and Australia In N Engl J Med 2003 348 2186 95 PMID 12773645 Lehrman G Hogue IB Palmer S et al Depletion of latent HIV 1 infection in vivo a proof of concept study In Lancet 2005 366 549 55 PMID 16099290 Melby T Sista P DeMasi R et al Characterization of envelope glycoprotein gp41 genotype and phenotypic susceptibility to enfuvirtide at baseline and on treatment in the phase III clinical trials TORO 1 and TORO 2 In AIDS Res Hum Retroviruses 2006 22 375 85 Abstract PMID 16706613 Menzo S Castagna A Monachetti A et al Resistance and replicative capacity of HIV 1 strains selected in vivo by long term enfuvirtide treatment In New Microbiol 2004 27 51 61 PMID 15646065 Mink M Mosier SM Janumpalli S et al Impact of human immunodeficiency virus type 1 gp41 amino acid substitutions selected during enfuvirtide treatment on gp41 binding and antiviral potency of enfuvirtide in vitro In J Virol 2005 79 12447 54 PMID 16160172 Molto J Ruiz L Valle M et al Increased antiretroviral potency by the addition of enfuvirtide to a four drug regimen in antiretroviral naive HIV infected patients In Antivir Ther 2006 11 47 51 Abstract PMID 16518959 Nelson M Arasteh K Clotet B et al Durable efficacy of enfuvirtide over 48 weeks in heavily treatment experienced HIV 1 infected patients in the T 20 versus optimized background regimen only 1 and 2 clinical trials In J AIDS 2005 40 404 12 PMID 16280694 Nelson M Fatkenheuer G Konourina I et al Efficacy and safety of maraviroc plus optimized background therapy in viremic ART experienced patients infected with CCR5 tropic HIV 1 in Europe Australia and North America 24 week results Abstract 104aLB 14th CROI 2007 Los Angeles Oldfield V Keating GM Plosker G Enfuvirtide A Review of its Use in the Management of HIV Infection In Drugs 2005 65 1139 60 PMID 15907147 Raffi F Katlama C Saag M et al Week 12 response to therapy as a predictor of week 24 48 and 96 outcome in patients receiving the HIV fusion inhibitor enfuvirtide in the T 20 versus Optimized Regimen Only TORO trials In Clin Infect Dis 2006 42 870 877 PMID 16477567 Stocker H Kloft C Plock N et al Pharmacokinetics of enfuvirtide in patients treated in typical routine clinical settings In Antimicrob Agents Chemother 2006 50 667 73 PMID 16436725 Thompson M DeJesus E Richmond G et al Pharmacokinetics pharmacodynamics and safety of once daily versus twice daily dosing with enfuvirtide in HIV infected subjects In AIDS 2006 20 397 404 PMID 16439873 Trottier B Walmsley S Reynes J et al Safety of enfuvirtide in combination with an optimized background of antiretrovirals in treatment experienced HIV 1 infected adults over 48 weeks In JAIDS 2005 40 413 421 PMID 16280695 Youle M Staszweski S Clotet B et al Concomitant use of an active boosted protease inhibitor with enfuvirtide in treatment experienced HIV infected individuals recent data and consensus recommendations In HIV Clin Trials 2006 7 86 96 PMID 16798623 Dieser Artikel behandelt ein Gesundheitsthema Er dient nicht der Selbstdiagnose und ersetzt nicht eine Diagnose durch einen Arzt Bitte hierzu den Hinweis zu Gesundheitsthemen beachten Abgerufen von https de wikipedia org w index php title Enfuvirtid amp oldid 235617115